NUDT4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NUDT4 protein.
Immunogen
NUDT4 (NP_061967.3, 1 a.a. ~ 180 a.a) full-length human protein.
Sequence
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NUDT4 expression in transfected 293T cell line (H00011163-T01) by NUDT4 MaxPab polyclonal antibody.
Lane 1: NUDT4 transfected lysate(19.8 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NUDT4
Entrez GeneID
11163GeneBank Accession#
NM_019094.4Protein Accession#
NP_061967.3Gene Name
NUDT4
Gene Alias
DIPP2, DIPP2alpha, DIPP2beta, DKFZp686I1281, HDCMB47P, KIAA0487
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Omim ID
609229Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq
Other Designations
diphosphoinositol polyphosphate phosphohydrolase type 2|nudix-type motif 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com