FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FGFR1OP expression in transfected 293T cell line (H00011116-T02) by FGFR1OP MaxPab polyclonal antibody.
Lane 1: FGFR1OP transfected lysate(43.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FGFR1OP protein.
Immunogen
FGFR1OP (NP_008976.1, 1 a.a. ~ 399 a.a) full-length human protein.
Sequence
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGFR1OP expression in transfected 293T cell line (H00011116-T02) by FGFR1OP MaxPab polyclonal antibody.
Lane 1: FGFR1OP transfected lysate(43.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FGFR1OP
Entrez GeneID
11116GeneBank Accession#
NM_007045Protein Accession#
NP_008976.1Gene Name
FGFR1OP
Gene Alias
FOP
Gene Description
FGFR1 oncogene partner
Omim ID
605392Gene Ontology
HyperlinkGene Summary
This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000017612|OTTHUMP00000017613|fibroblast growth factor receptor 1 oncogene partner
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com