ATE1 monoclonal antibody (M01), clone 2B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ATE1 monoclonal antibody (M01), clone 2B6. Western Blot analysis of ATE1 expression in Jurkat(Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ATE1 expression in transfected 293T cell line by ATE1 monoclonal antibody (M01), clone 2B6.
Lane 1: ATE1 transfected lysate (Predicted MW: 59 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATE1 is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ATE1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATE1.
Immunogen
ATE1 (NP_001001976, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (77)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATE1 monoclonal antibody (M01), clone 2B6. Western Blot analysis of ATE1 expression in Jurkat(Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ATE1 expression in transfected 293T cell line by ATE1 monoclonal antibody (M01), clone 2B6.
Lane 1: ATE1 transfected lysate (Predicted MW: 59 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATE1 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ATE1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ATE1
Entrez GeneID
11101GeneBank Accession#
NM_001001976Protein Accession#
NP_001001976Gene Name
ATE1
Gene Alias
MGC26724
Gene Description
arginyltransferase 1
Omim ID
607103Gene Ontology
HyperlinkGene Summary
This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000020637|OTTHUMP00000058665|R-transferase 1|arginine-tRNA--protein transferase 1|arginyl-tRNA-protein transferase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com