Product Browser

Last updated: 2014/7/7
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATE1 polyclonal antibody (A01)

  • Catalog # : H00011101-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ATE1.
  • Immunogen:
  • ATE1 (NP_001001976, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011101-A01
    Western Blot detection against Immunogen (35.68 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATE1 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of ATE1 expression in HeLa ( Cat # L013V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ATE1
  • Gene Alias:
  • MGC26724
  • Gene Description:
  • arginyltransferase 1
  • Gene Summary:
  • This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020637,OTTHUMP00000058665,R-transferase 1,arginine-tRNA--protein transferase 1,arginyl-tRNA-protein transferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook