CPSF6 monoclonal antibody (M10), clone 3F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CPSF6.
Immunogen
CPSF6 (NP_008938, 37 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CPSF6 monoclonal antibody (M10), clone 3F11. Western Blot analysis of CPSF6 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
CPSF6 monoclonal antibody (M10), clone 3F11 Western Blot analysis of CPSF6 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CPSF6 monoclonal antibody (M10), clone 3F11. Western Blot analysis of CPSF6 expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CPSF6 expression in transfected 293T cell line by CPSF6 monoclonal antibody (M10), clone 3F11.
Lane 1: CPSF6 transfected lysate(59.21 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CPSF6 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CPSF6
Entrez GeneID
11052GeneBank Accession#
NM_007007Protein Accession#
NP_008938Gene Name
CPSF6
Gene Alias
CFIM, CFIM68, HPBRII-4, HPBRII-7
Gene Description
cleavage and polyadenylation specific factor 6, 68kDa
Omim ID
604979Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins. [provided by RefSeq
Other Designations
cleavage and polyadenylation specific factor 6, 68 kD subunit|cleavage and polyadenylation specific factor 6, 68kD subunit|pre-mRNA cleavage factor I, 68kD subunit|pre-mRNA cleavage factor Im (68kD)
-
Interactome
-
Publication Reference
-
Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation.
Kim S, Yamamoto J, Chen Y, Aida M, Wada T, Handa H, Yamaguchi Y.
Genes to Cells 2010 Sep; 15(9):1003.
Application:WB-Tr, Human, HeLa cells.
-
Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
Larriba MJ, Casado-Vela J, Pendas-Franco N, Pena R, Garcia de Herreros A, Berciano MT, Lafarga M, Casal JI, Munoz A.
PLoS One 2010 Apr; 5(4):e10221.
Application:WB, Human, SW480-ADH cells.
-
Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com