LILRA3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LILRA3 expression in transfected 293T cell line (H00011026-T01) by LILRA3 MaxPab polyclonal antibody.
Lane 1: LILRA3 transfected lysate(48.29 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human LILRA3 protein.
Immunogen
LILRA3 (NP_006856.2, 1 a.a. ~ 439 a.a) full-length human protein.
Sequence
MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LILRA3 expression in transfected 293T cell line (H00011026-T01) by LILRA3 MaxPab polyclonal antibody.
Lane 1: LILRA3 transfected lysate(48.29 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LILRA3
Entrez GeneID
11026GeneBank Accession#
NM_006865.2Protein Accession#
NP_006856.2Gene Name
LILRA3
Gene Alias
CD85E, HM31, HM43, ILT6, LIR-4, LIR4, e3
Gene Description
leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
Omim ID
604818Gene Ontology
HyperlinkGene Summary
Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades (see LILRA1, MIM 604810). One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor (Borges et al., 1997 [PubMed 9548455]).[supplied by OMIM
Other Designations
OTTHUMP00000067955|OTTHUMP00000067957|leucocyte immunoglobulin-like receptor|leukocyte immunoglobulin-like receptor 4|leukocyte immunoglobulin-like receptor A3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com