IL24 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of IL24 expression in transfected 293T cell line (H00011009-T02) by IL24 MaxPab polyclonal antibody.
Lane 1: IL24 transfected lysate(23.80 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL24 protein.
Immunogen
IL24 (NP_006841.1, 1 a.a. ~ 206 a.a) full-length human protein.
Sequence
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (63)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL24 expression in transfected 293T cell line (H00011009-T02) by IL24 MaxPab polyclonal antibody.
Lane 1: IL24 transfected lysate(23.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IL24
Entrez GeneID
11009GeneBank Accession#
NM_006850Protein Accession#
NP_006841.1Gene Name
IL24
Gene Alias
C49A, FISP, IL-24, IL10B, MDA7, Mob-5, ST16, mda-7
Gene Description
interleukin 24
Omim ID
604136Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
IL-24 splice variant delE3|IL-24 splice variant delE5|OTTHUMP00000034620|melanoma differentiation association protein 7|suppression of tumorigenicity 16 (melanoma differentiation)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com