- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Membrane > Transporter > SLC27A4 monoclonal antibody (M01), clone 1F4-1B10
SLC27A4 monoclonal antibody (M01), clone 1F4-1B10
- Catalog # : H00010999-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a full length recombinant SLC27A4.
- Immunogen:
- SLC27A4 (AAH09959.1, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG1 kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.81 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Interactions between FATP4 and ichthyin in epidermal lipid processing may provide clues to the pathogenesis of autosomal recessive congenital ichthyosis.
Li H, Vahlquist A, Torma H.J Dermatol Sci. 2012 Dec 13. pii: S0923-1811(12)00938-3. doi: 10.1016/j.jdermsci.2012.11.593.
- 2.
- Adipokines promote lipotoxicity in human skeletal muscle cells.
Taube A, Lambernd S, van Echten-Deckert G, Eckardt K, Eckel J.Arch Physiol Biochem. 2012 Jul;118(3):92-101. Epub 2012 Jun 12.
- 3.
- Modulation of Fatty Acid Transport and Metabolism by Obesity in the Human Full-Term Placenta.
Dube E, Gravel A, Martin C, Desparois G, Moussa I, Ethier-Chiasson M, Forest JC, Giguere Y, Masse A, Lafond J.Biol Reprod. 2012 May 2.
- 4.
- Mutations in the Fatty Acid Transport Protein 4 Gene Cause the Ichthyosis Prematurity Syndrome.
Klar J, Schweiger M, Zimmerman R, Zechner R, Li H, Torma H, Vahlquist A, Bouadjar B, Dahl N, Fischer J.Am J Hum Genet. 2009 Aug;85(2):248-53. Epub 2009 Jul 23.
- 5.
- Fatty acid transport and activation and the expression patterns of genes involved in fatty acid trafficking.
Sandoval A, Fraisl P, Arias-Barrau E, DiRusso CD, Singer D, Sealls W, Black PN.Arch Biochem Biophys. 2008 Sep 15;477(2):363-71. Epub 2008 Jun 20.
- Applications
- Western Blot (Cell lysate)
- SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 Western Blot analysis of SLC27A4 expression in HeLa ( Cat # L013V1 ).
- Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged SLC27A4 is 0.1 ng/ml as a capture antibody.
- Protocol Download
- Entrez GeneID:
- 10999
- GeneBank Accession#:
- BC009959
- Protein Accession#:
- AAH09959.1
- Gene Name:
- SLC27A4
- Gene Alias:
- ACSVL4,FATP4
- Gene Description:
- solute carrier family 27 (fatty acid transporter), member 4
- Omim ID:
- 604194
- Gene Ontology:
- Hyperlink
- Other Designations:
- OTTHUMP00000022264,fatty acid transport protein 4
- Gene Pathway
