AF1Q monoclonal antibody (M01), clone 2A9-1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AF1Q.
Immunogen
AF1Q (AAH09624, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (82)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MLLT11 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MLLT11
Entrez GeneID
10962GeneBank Accession#
BC009624Protein Accession#
AAH09624Gene Name
MLLT11
Gene Alias
AF1Q, RP11-316M1.10
Gene Description
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11
Omim ID
604684Gene Ontology
HyperlinkGene Summary
The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested. [provided by RefSeq
Other Designations
ALL1 fused gene from chromosome 1q|ALL1-fused gene from chromosome 1q|MLLT11 protein|OTTHUMP00000033120
-
Interactome
-
Publication Reference
-
MLLT11/AF1q is differentially expressed in maturing neurons during development.
Yamada M, Clark J, Iulianella A.
Gene Expression Patterns 2014 Jul; 15(2):80.
Application:IHC, Mouse, Cortex, Spinal cord, Eye.
-
AF1q: a novel mediator of basal and 4-HPR-induced apoptosis in ovarian cancer cells.
Tiberio P, Cavadini E, Callari M, Daidone MG, Appierto V.
PLoS One 2012 Jun; 7(6):e39968.
Application:WB, Human, A2780, HeLa, OVCA432, OVCAR-3, SKOV-3, SK-N-BE cells.
-
AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway.
Parcelier A, Maharzi N, Delord M, Robledo-Sarmiento M, Nelson E, Belakhdar-Mekid H, Pla M, Kuranda K, Parietti V, Goodhardt M, Legrand N, Bernstein ID, Gluckman JC, Sigaux F, Canque B.
Blood 2011 Aug; 118(7):1784.
Application:IF, WB-Tr, Human, SupT1, HEK293T cells.
-
Oncogene AF1q enhances doxorubicin-induced apoptosis through BAD-mediated mitochondrial apoptotic pathway.
Co NN, Tsang WP, Wong TW, Cheung HH, Tsang TY, Kong SK, Kwok TT.
Molecular Cancer Therapeutics 2008 Oct; 7(10):3160.
Application:WB, Human, A431, AP, HepG2, HL60 cells.
-
Identification of the functional role of AF1Q in the progression of breast cancer.
Chang XZ, Li DQ, Hou YF, Wu J, Lu JS, Di GH, Jin W, Ou ZL, Shen ZZ, Shao ZM.
Breast Cancer Research and Treatment 2007 Oct; 111(1):65.
Application:IF, WB, Human, MDA-MB-231 cells.
-
MLLT11/AF1q is differentially expressed in maturing neurons during development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com