PRSS21 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PRSS21 expression in transfected 293T cell line (H00010942-T01) by PRSS21 MaxPab polyclonal antibody.
Lane 1: PRSS21 transfected lysate(34.54 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PRSS21 protein.
Immunogen
PRSS21 (NP_006790.1, 1 a.a. ~ 314 a.a) full-length human protein.
Sequence
MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (62)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PRSS21 expression in transfected 293T cell line (H00010942-T01) by PRSS21 MaxPab polyclonal antibody.
Lane 1: PRSS21 transfected lysate(34.54 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PRSS21
Entrez GeneID
10942GeneBank Accession#
NM_006799.2Protein Accession#
NP_006790.1Gene Name
PRSS21
Gene Alias
ESP-1, ESP1, TEST1, TESTISIN
Gene Description
protease, serine, 21 (testisin)
Omim ID
608159Gene Ontology
HyperlinkGene Summary
This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms. [provided by RefSeq
Other Designations
serine protease from eosinophils|testisin
-
Interactome
-
Publication Reference
-
Interaction of testisin with maspin and its impact on invasion and cell death resistance of cervical cancer cells.
Yeom SY, Jang HL, Lee SJ, Kim E, Son HJ, Kim BG, Park C.
FEBS Letters 2010 Apr; 584(8):1469.
Application：IF, WB-Tr, Human, HeLa cells.
-
Interaction of testisin with maspin and its impact on invasion and cell death resistance of cervical cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com