Product Browser

Last updated: 2014/8/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDAR polyclonal antibody (A01)

  • Catalog # : H00010913-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EDAR.
  • Immunogen:
  • EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010913-A01
    Western Blot detection against Immunogen (38.76 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EDAR polyclonal antibody (A01), Lot # 050921JC01. Western Blot analysis of EDAR expression in Daoy.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EDAR
  • Gene Alias:
  • DL,ED1R,ED3,ED5,EDA-A1R,EDA1R,EDA3,FLJ94390
  • Gene Description:
  • ectodysplasin A receptor
  • Gene Summary:
  • This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq
  • Other Designations:
  • downless, mouse, homolog of,ectodysplasin 1, anhidrotic receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook