GADD45G monoclonal antibody (M01), clone 1D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GADD45G is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.23 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant GADD45G.
Immunogen
GADD45G (AAH19325, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.23 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GADD45G is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GADD45G
Entrez GeneID
10912GeneBank Accession#
BC019325Protein Accession#
AAH19325Gene Name
GADD45G
Gene Alias
CR6, DDIT2, GADD45gamma, GRP17
Gene Description
growth arrest and DNA-damage-inducible, gamma
Omim ID
604949Gene Ontology
HyperlinkGene Summary
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq
Other Designations
GADD45-gamma|OTTHUMP00000021623|gadd-related protein, 17 kD
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The novel histone deacetylase inhibitor, LBH589, induces expression of DNA damage response genes and apoptosis in Ph- acute lymphoblastic leukemia cells.
Scuto A, Kirschbaum M, Kowolik C, Kretzner L, Juhasz A, Atadja P, Pullarkat V, Bhatia R, Forman S, Yen Y, Jove R.
Blood 2008 Mar; 111(10):5093.
Application：WB-Ce, Human, MOLT-4, Reh cells.
-
The novel histone deacetylase inhibitor, LBH589, induces expression of DNA damage response genes and apoptosis in Ph- acute lymphoblastic leukemia cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com