KHDRBS1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KHDRBS1 full-length ORF ( AAH10132.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
67.4
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KHDRBS1
Entrez GeneID
10657GeneBank Accession#
BC010132.2Protein Accession#
AAH10132.1Gene Name
KHDRBS1
Gene Alias
FLJ34027, Sam68, p62
Gene Description
KH domain containing, RNA binding, signal transduction associated 1
Omim ID
602489Gene Ontology
HyperlinkGene Summary
RNA binding
Other Designations
GAP-associated tyrosine phosphoprotein p62 (Sam68)|OTTHUMP00000004022
-
Interactome
-
Publication Reference
-
The nuclear protein Sam68 is cleaved by the FMDV 3C protease redistributing Sam68 to the cytoplasm during FMDV infection of host cells.
Lawrence P, Schafer EA, Rieder E.
Virology 2012 Mar; 425(1):40.
Application:Func, Recombinant protease, RNA.
-
The nuclear protein Sam68 is cleaved by the FMDV 3C protease redistributing Sam68 to the cytoplasm during FMDV infection of host cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com