CREB3 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00010488-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CREB3 expression in transfected 293T cell line (H00010488-T02) by CREB3 MaxPab polyclonal antibody.

Lane 1: CREB3 transfected lysate(41.40 KDa).
Lane 2: Non-transfected lysate.

Western Blot (Recombinant protein)
Application

Western Blot (Recombinant protein)

Western Blot analysis of CREB3 recombinant protein (H00010488-P01) by CREB3 purified MaxPab rabbit polyclonal antibody.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human CREB3 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein.

    Sequence

    MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

    Host

    Rabbit

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (66); Rat (55)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of CREB3 expression in transfected 293T cell line (H00010488-T02) by CREB3 MaxPab polyclonal antibody.

    Lane 1: CREB3 transfected lysate(41.40 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Western Blot analysis of CREB3 recombinant protein (H00010488-P01) by CREB3 purified MaxPab rabbit polyclonal antibody.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — CREB3

    Entrez GeneID

    10488

    GeneBank Accession#

    BC009402.2

    Protein Accession#

    AAH09402.1

    Gene Name

    CREB3

    Gene Alias

    LUMAN, LZIP, MGC15333, MGC19782

    Gene Description

    cAMP responsive element binding protein 3

    Omim ID

    606443

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq

    Other Designations

    OTTHUMP00000021348|basic leucine zipper protein|cyclic AMP response element (CRE)-binding protein/activating transcription factor 1|transcription factor LZIP-alpha

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All