CREB3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CREB3 protein.
Immunogen
CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein.
Sequence
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (55)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CREB3 expression in transfected 293T cell line (H00010488-T02) by CREB3 MaxPab polyclonal antibody.
Lane 1: CREB3 transfected lysate(41.40 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Western Blot analysis of CREB3 recombinant protein (H00010488-P01) by CREB3 purified MaxPab rabbit polyclonal antibody.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CREB3
Entrez GeneID
10488GeneBank Accession#
BC009402.2Protein Accession#
AAH09402.1Gene Name
CREB3
Gene Alias
LUMAN, LZIP, MGC15333, MGC19782
Gene Description
cAMP responsive element binding protein 3
Omim ID
606443Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000021348|basic leucine zipper protein|cyclic AMP response element (CRE)-binding protein/activating transcription factor 1|transcription factor LZIP-alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.
Hacker B, Schultheiß C, Döring M, Kurzik-Dumke U.
Human Molecular Genetics 2018 Jun; 27(11):1858.
Application:IP, Human, HEK 293 cells.
-
Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com