HAX1 monoclonal antibody (M04), clone 1D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant HAX1.
Immunogen
HAX1 (NP_006109.2, 76 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (80)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HAX1 expression in transfected 293T cell line by HAX1 monoclonal antibody (M04), clone 1D2.
Lane 1: HAX1 transfected lysate(31.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HAX1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HAX1
Entrez GeneID
10456GeneBank Accession#
NM_006118Protein Accession#
NP_006109.2Gene Name
HAX1
Gene Alias
FLJ17042, FLJ18492, FLJ93803, HCLSBP1, HS1BP1, SCN3
Gene Description
HCLS1 associated protein X-1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
HCLS1 (and PKD2) associated protein|HS1 binding protein|OTTHUMP00000034190
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com