PPIE purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PPIE MaxPab rabbit polyclonal antibody. Western Blot analysis of PPIE expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of PPIE expression in transfected 293T cell line (H00010450-T02) by PPIE MaxPab polyclonal antibody.
Lane 1: PPIE transfected lysate(33.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PPIE protein.
Immunogen
PPIE (NP_006103.1, 1 a.a. ~ 301 a.a) full-length human protein.
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPIE MaxPab rabbit polyclonal antibody. Western Blot analysis of PPIE expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PPIE expression in transfected 293T cell line (H00010450-T02) by PPIE MaxPab polyclonal antibody.
Lane 1: PPIE transfected lysate(33.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PPIE
Entrez GeneID
10450GeneBank Accession#
NM_006112.2Protein Accession#
NP_006103.1Gene Name
PPIE
Gene Alias
CYP-33, MGC111222, MGC3736
Gene Description
peptidylprolyl isomerase E (cyclophilin E)
Omim ID
602435Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000010837|OTTHUMP00000010838|PPIase E|cyclophilin 33|cyclophilin E|peptidyl-prolyl cis-trans isomerase E|peptidylprolyl isomerase E|peptidylprolyl isomerase E, isoform 1|rotamase E
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com