C1D monoclonal antibody (M03), clone 6H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant C1D.
Immunogen
C1D (AAH05235, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.25 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
C1D monoclonal antibody (M03), clone 6H2 Western Blot analysis of C1D expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of C1D expression in transfected 293T cell line by C1D monoclonal antibody (M03), clone 6H2.
Lane 1: C1D transfected lysate(16 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to C1D on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C1D is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to C1D on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — C1D
Entrez GeneID
10438GeneBank Accession#
BC005235Protein Accession#
AAH05235Gene Name
C1D
Gene Alias
MGC12261, MGC14659, SUNCOR
Gene Description
nuclear DNA-binding protein
Omim ID
606997Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
C1D DNA-binding protein|small unique nuclear receptor corepressor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com