IFI30 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IFI30 MaxPab polyclonal antibody. Western Blot analysis of IFI30 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of IFI30 expression in transfected 293T cell line by IFI30 MaxPab polyclonal antibody.
Lane 1: IFI30 transfected lysate(27.5 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IFI30 protein.
Immunogen
IFI30 (NP_006323, 1 a.a. ~ 250 a.a) full-length human protein.
Sequence
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62); Rat (62)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IFI30 MaxPab polyclonal antibody. Western Blot analysis of IFI30 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of IFI30 expression in transfected 293T cell line by IFI30 MaxPab polyclonal antibody.
Lane 1: IFI30 transfected lysate(27.5 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IFI30
Entrez GeneID
10437GeneBank Accession#
NM_006332Protein Accession#
NP_006323Gene Name
IFI30
Gene Alias
GILT, IFI-30, IP30, MGC32056
Gene Description
interferon, gamma-inducible protein 30
Omim ID
604664Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq
Other Designations
gamma-interferon-inducible lysosomal thiol reductase|interferon gamma-inducible protein 30 preproprotein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com