CACNG3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CACNG3 MaxPab polyclonal antibody. Western Blot analysis of CACNG3 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of CACNG3 expression in transfected 293T cell line (H00010368-T02) by CACNG3 MaxPab polyclonal antibody.
Lane 1: CACNG3 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CACNG3 on 293T cell. [antibody concentration 1 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CACNG3 protein.
Immunogen
CACNG3 (NP_006530.1, 1 a.a. ~ 315 a.a) full-length human protein.
Sequence
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CACNG3 MaxPab polyclonal antibody. Western Blot analysis of CACNG3 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of CACNG3 expression in transfected 293T cell line (H00010368-T02) by CACNG3 MaxPab polyclonal antibody.
Lane 1: CACNG3 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CACNG3 on 293T cell. [antibody concentration 1 ug/ml] -
Gene Info — CACNG3
Entrez GeneID
10368GeneBank Accession#
NM_006539Protein Accession#
NP_006530.1Gene Name
CACNG3
Gene Alias
Cacng2
Gene Description
calcium channel, voltage-dependent, gamma subunit 3
Omim ID
606403Gene Ontology
HyperlinkGene Summary
L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This protein is similar to the mouse stargazin protein, mutations in which have been associated with absence seizures, also known as petit-mal or spike-wave seizures. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family. This gene is a candidate gene for a familial infantile convulsive disorder with paroxysomal choreoathetosis. [provided by RefSeq
Other Designations
neuronal voltage-gated calcium channel gamma-3 subunit|voltage-dependent calcium channel gamma-3 subunit|voltage-gated calcium channel gamma subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com