APEG1 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SPEG expression in transfected 293T cell line (H00010290-T01) by SPEG MaxPab polyclonal antibody.
Lane 1: APEG1 transfected lysate(12.43 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human APEG1 protein.
Immunogen
APEG1 (AAH06346.1, 1 a.a. ~ 113 a.a) full-length human protein.
Sequence
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPEG expression in transfected 293T cell line (H00010290-T01) by SPEG MaxPab polyclonal antibody.
Lane 1: APEG1 transfected lysate(12.43 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SPEG
Entrez GeneID
10290GeneBank Accession#
BC006346.2Protein Accession#
AAH06346.1Gene Name
SPEG
Gene Alias
APEG1, BPEG, KIAA1297, MGC12676, SPEGalpha, SPEGbeta
Gene Description
SPEG complex locus
Gene Ontology
HyperlinkGene Summary
Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq
Other Designations
OTTHUMP00000064868|aortic preferentially expressed gene 1|aortic preferentially expressed protein 1|nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury|striated muscle preferentially expressed protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com