GDF11 monoclonal antibody (M03), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GDF11 monoclonal antibody (M03), clone 1E6. Western Blot analysis of GDF11 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
GDF11 monoclonal antibody (M03), clone 1E6 Western Blot analysis of GDF11 expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GDF11 is approximately 0.3ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GDF11.
Immunogen
GDF11 (NP_005802, 310 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GDF11 monoclonal antibody (M03), clone 1E6. Western Blot analysis of GDF11 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
GDF11 monoclonal antibody (M03), clone 1E6 Western Blot analysis of GDF11 expression in K-562 ( Cat # L009V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GDF11 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — GDF11
Entrez GeneID
10220GeneBank Accession#
NM_005811Protein Accession#
NP_005802Gene Name
GDF11
Gene Alias
BMP-11, BMP11
Gene Description
growth differentiation factor 11
Omim ID
603936Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq
Other Designations
bone morphogenetic protein 11
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com