ACTR1A monoclonal antibody (M08), clone 3E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACTR1A.
Immunogen
ACTR1A (NP_005727, 279 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACTR1A is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ACTR1A
Entrez GeneID
10121GeneBank Accession#
NM_005736Protein Accession#
NP_005727Gene Name
ACTR1A
Gene Alias
ARP1, CTRN1, FLJ52695, FLJ52800, FLJ55002
Gene Description
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
Omim ID
605143Gene Ontology
HyperlinkGene Summary
This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq
Other Designations
ARP1 actin-related protein 1 homolog A, centractin alpha|ARP1, yeast homolog A|OTTHUMP00000020366|actin-RPV|centractin alpha|centrosome-associated actin homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com