AP1M2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of AP1M2 expression in transfected 293T cell line by AP1M2 MaxPab polyclonal antibody.
Lane 1: AP1M2 transfected lysate(46.53 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AP1M2 protein.
Immunogen
AP1M2 (NP_005489, 1 a.a. ~ 423 a.a) full-length human protein.
Sequence
MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AP1M2 expression in transfected 293T cell line by AP1M2 MaxPab polyclonal antibody.
Lane 1: AP1M2 transfected lysate(46.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AP1M2
Entrez GeneID
10053GeneBank Accession#
NM_005498Protein Accession#
NP_005489Gene Name
AP1M2
Gene Alias
AP1-mu2, HSMU1B, MU-1B, MU1B, mu2
Gene Description
adaptor-related protein complex 1, mu 2 subunit
Omim ID
607309Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. [provided by RefSeq
Other Designations
AP-mu chain family member mu1B|HA1 47 kDa subunit 2|clathrin assembly protein complex 1 medium chain 2|clathrin coat assembly protein AP47 2|clathrin coat associated protein AP47 2|clathrin-associated adaptor medium chain mu2|golgi adaptor AP-1 47 kDa pro
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com