Product Browser

Last updated: 2014/12/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC12A6 polyclonal antibody (A01)

  • Catalog # : H00009990-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
  • Immunogen:
  • SLC12A6 (NP_005126, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009990-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9990
  • Gene Name:
  • SLC12A6
  • Gene Alias:
  • ACCPN,DKFZp434D2135,KCC3,KCC3A,KCC3B
  • Gene Description:
  • solute carrier family 12 (potassium/chloride transporters), member 6
  • Gene Summary:
  • This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq
  • Other Designations:
  • potassium chloride cotransporter 3,potassium chloride cotransporter KCC3a-S3,solute carrier family 12, member 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook