- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Polyclonal Ab > Human > Membrane > Transporter > SLC12A6 polyclonal antibody (A01)
SLC12A6 polyclonal antibody (A01)
- Catalog # : H00009990-A01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 uL
- USD $ 229
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
- Immunogen:
- SLC12A6 (NP_005126, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
- Sequence:
- MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
- Host:
- Mouse
- Reactivity:
- Human
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.01 KDa) .
- Storage Buffer:
- 50 % glycerol
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Loss of Neuronal Potassium/Chloride Cotransporter 3 (KCC3) Is Responsible for the Degenerative Phenotype in a Conditional Mouse Model of Hereditary Motor and Sensory Neuropathy Associated with Agenesis of the Corpus Callosum.
Shekarabi M, Moldrich RX, Rasheed S, Salin-Cantegrel A, Laganiere J, Rochefort D, Hince P, Huot K, Gaudet R, Kurniawan N, Sotocinal SG, Ritchie J, Dion PA, Mogil JS, Richards LJ, Rouleau GA.J Neurosci. 2012 Mar 14;32(11):3865-3876.
- 2.
- Transit defect of the potassium-chloride co-transporter 3 is a major pathogenic mechanism in hereditary motor and sensory neuropathy with agenesis of the corpus callosum.
Salin-Cantegrel A, Riviere JB, Shekarabi M, Rasheed S, Dacal S, Laganiere J, Gaudet R, Rochefort D, Lesca G, Gaspar C, Dion PA, Lapointe JY, Rouleau GA.J Biol Chem. 2011 Aug 12;286(32):28456-65. Epub 2011 May 31.
- 3.
- HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- cotransporter 3.
Salin-Cantegrel A, Shekarabi M, Holbert S, Dion P, Rochefort D, Laganiere J, Dacal S, Hince P, Karemera L, Gaspar C, Lapointe JY, Rouleau GA.Hum Mol Genet. 2008 Sep 1;17(17):2703-11. Epub 2008 Jun 19.
- Application Image
- Western Blot (Recombinant protein)
- ELISA
- Entrez GeneID:
- 9990
- GeneBank Accession#:
- NM_005135
- Protein Accession#:
- NP_005126
- Gene Name:
- SLC12A6
- Gene Alias:
- ACCPN,DKFZp434D2135,KCC3,KCC3A,KCC3B
- Gene Description:
- solute carrier family 12 (potassium/chloride transporters), member 6
- Gene Ontology:
- Hyperlink
- Gene Summary:
- This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq
- Other Designations:
- potassium chloride cotransporter 3,potassium chloride cotransporter KCC3a-S3,solute carrier family 12, member 6
