NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NR1D2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NR1D2 expression in mouse liver.
Western Blot (Cell lysate)
NR1D2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NR1D2 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of NR1D2 expression in transfected 293T cell line (H00009975-T02) by NR1D2 MaxPab polyclonal antibody.
Lane 1: NR1D2 transfected lysate(64.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NR1D2 protein.
Immunogen
NR1D2 (NP_005117.2, 1 a.a. ~ 579 a.a) full-length human protein.
Sequence
MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NR1D2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NR1D2 expression in mouse liver.Western Blot (Cell lysate)
NR1D2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NR1D2 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of NR1D2 expression in transfected 293T cell line (H00009975-T02) by NR1D2 MaxPab polyclonal antibody.
Lane 1: NR1D2 transfected lysate(64.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NR1D2
Entrez GeneID
9975GeneBank Accession#
NM_005126.2Protein Accession#
NP_005117.2Gene Name
NR1D2
Gene Alias
BD73, EAR-1r, HZF2, Hs.37288, RVR
Gene Description
nuclear receptor subfamily 1, group D, member 2
Omim ID
602304Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
Rev-erb-beta
-
Interactome
-
Publication Reference
-
Ruscogenin Prevents Folic Acid-Induced Acute Kidney Damage by Inhibiting Rev-erb α/ β- Mediated Ferroptosis.
Mingyue Hu, Songbo An.
Computational Intelligence and Neuroscience 2022 Jul; 2022:8066126.
Application：WB, Mouse, Kidney tissue.
-
Role of the CLOCK protein in liver detoxification.
Zhao M, Zhao H, Deng J, Guo L, Wu B.
British Journal of Pharmacology 2019 Dec; 176(24):4639.
Application：WB-Ti, Mouse, Liver.
-
Ruscogenin Prevents Folic Acid-Induced Acute Kidney Damage by Inhibiting Rev-erb α/ β- Mediated Ferroptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com