Product Browser

Last updated: 2014/10/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00009966-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TNFSF15 protein.
  • Immunogen:
  • TNFSF15 (NP_005109.2, 1 a.a. ~ 251 a.a) full-length human protein.
  • Sequence:
  • MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TNFSF15 expression in transfected 293T cell line (H00009966-T02) by TNFSF15 MaxPab polyclonal antibody.

    Lane 1: TNFSF15 transfected lysate(28.10 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 9966
  • Gene Name:
  • TNFSF15
  • Gene Alias:
  • MGC129934,MGC129935,TL1,TL1A,VEGI,VEGI192A
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 15
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022739,TNF ligand-related molecule 1,TNF superfamily ligand TL1A,vascular endothelial cell growth inhibitor,vascular endothelial growth inhibitor-192A
  • RSS
  • YouTube
  • Linkedin
  • Facebook