TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TNFSF15 protein.
Immunogen
TNFSF15 (NP_005109.2, 1 a.a. ~ 251 a.a) full-length human protein.
Sequence
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNFSF15 expression in transfected 293T cell line (H00009966-T02) by TNFSF15 MaxPab polyclonal antibody.
Lane 1: TNFSF15 transfected lysate(28.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TNFSF15
Entrez GeneID
9966GeneBank Accession#
NM_005118Protein Accession#
NP_005109.2Gene Name
TNFSF15
Gene Alias
MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Gene Description
tumor necrosis factor (ligand) superfamily, member 15
Omim ID
604052Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000022739|TNF ligand-related molecule 1|TNF superfamily ligand TL1A|vascular endothelial cell growth inhibitor|vascular endothelial growth inhibitor-192A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com