USP15 monoclonal antibody (M01), clone 1C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
USP15 monoclonal antibody (M01), clone 1C10 Western Blot analysis of USP15 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of USP15 expression in transfected 293T cell line by USP15 monoclonal antibody (M01), clone 1C10.
Lane 1: USP15 transfected lysate (Predicted MW: 109.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP15 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (51.59 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant USP15.
Immunogen
USP15 (AAH20688, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (97)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.59 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
USP15 monoclonal antibody (M01), clone 1C10 Western Blot analysis of USP15 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of USP15 expression in transfected 293T cell line by USP15 monoclonal antibody (M01), clone 1C10.
Lane 1: USP15 transfected lysate (Predicted MW: 109.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP15 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — USP15
Entrez GeneID
9958GeneBank Accession#
BC020688Protein Accession#
AAH20688Gene Name
USP15
Gene Alias
KIAA0529, MGC131982, MGC149838, MGC74854, UNPH4
Gene Description
ubiquitin specific peptidase 15
Omim ID
604731Gene Ontology
HyperlinkGene Summary
Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).[supplied by OMIM
Other Designations
deubiquitinating enzyme|ubiquitin specific protease 15
-
Interactome
-
Disease
-
Publication Reference
-
Latent CSN-CRL complexes are crucial for curcumin-induced apoptosis and recruited during adipogenesis to lipid droplets via small GTPase RAB18.
Dawadschargal Dubiel, Jing Wang, Roland Hartig, Supattra Chaithongyot, Wolfgang Dubiel, Michael Naumann.
iScience 2023 Mar; 26(4):106468.
Application：WB-Ce, Human, HeLa, LiSa-2 cells.
-
Hypoxia-induced paclitaxel resistance in cervical cancer modulated by miR-100 targeting of USP15.
Hirotaka Nishi, Masanori Ono, Shinichiro Ohno, Zenta Yamanaka, Toru Sasaki, Kazuma Ohyashiki, Junko H Ohyashiki, Masahiko Kuroda.
Gynecologic Oncology Reports 2023 Jan; 45:101138.
Application：WB-Ce, Human, HeLa, SiHa cells.
-
The deubiquitylase USP15 regulates topoisomerase II alpha to maintain genome integrity.
Fielding AB, Concannon M, Darling S, Rusilowicz-Jones EV, Sacco JJ, Prior IA, Clague MJ, Urbé S, Coulson JM.
Oncogene 2018 Apr; 37(17):2326.
Application：WB-Tr, Human, A-549, U-2 OS cells.
-
The human papillomavirus E6 oncoprotein targets USP15 and TRIM25 to suppress RIG-I-mediated innate immune signaling.
Chiang C, Pauli EK, Biryukov J, Feister KF, Meng M, White EA, Münger K, Howley PM, Meyers C, Gack MU.
Journal of Virology 2018 Feb; 92(6):e01737.
Application：WB, Human, C33A cells.
-
Ubiquitin Specific Peptidase 15 (USP15) suppresses glioblastoma cell growth via stabilization of HECTD1 E3 ligase attenuating WNT pathway activity.
Oikonomaki M, Bady P, Hegi ME.
Oncotarget 2017 Nov; 8(66):110490.
Application：WB, Human, LN-229 cells.
-
The Deubiquitinating Enzyme USP5 Modulates Neuropathic and Inflammatory Pain by Enhancing Cav3.2 Channel Activity.
García-Caballero A, Gadotti VM, Stemkowski P, Weiss N, Souza IA, Hodgkinson V, Bladen C, Chen L, Hamid J, Pizzoccaro A, Deage M, François A, Bourinet E, Zamponi GW.
Neuron 2014 Sep; 83(5):1144.
Application：IP, Co-IP, IP-WB, Rat, Mouse, Rat brain tissue, Mouse DRG neurons.
-
The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy.
Cornelissen T, Haddad D, Wauters F, Van Humbeeck C, Mandemakers W, Koentjoro B, Sue C, Gevaert K, De Strooper B, Verstreken P, Vandenberghe W.
Human Molecular Genetics 2014 Oct; 23(19):5227.
Application：IF, WB-Tr, WB-Ti, Human, Mouse, Fibroblasts, Brain, Heart, Muscle, Lung, Liver, Kidney, Spleen, Testis, HEK293, HeLa cells.
-
The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
Pauli EK, Chan YK, Davis ME, Gableske S, Wang MK, Feister KF, Gack MU.
Science Signaling 2014 Jan; 7(307):ra3.
Application：IP-WB, WB-Tr, Human, HEK 293T cells, Normal human lung fibroblasts.
-
The Human COP9 Signalosome Protects Ubiquitin-conjugating Enzyme 3 (UBC3/Cdc34) from {beta}-Transducin Repeat-containing Protein ({beta}TrCP)-mediated Degradation.
Fernandez-Sanchez ME, Sechet E, Margottin-Goguet F, Rogge L, Bianchi E.
The Journal of Biological Chemistry 2010 Jun; 285(23):17390.
Application：WB-Tr, Human, HeLa cells.
-
COP9 Signalosome Interacts ATP-dependently with p97/Valosin-containing Protein (VCP) and Controls the Ubiquitination Status of Proteins Bound to p97/VCP.
Cayli S, Klug J, Chapiro J, Frohlich S, Krasteva G, Orel L, Meinhardt A.
The Journal of Biological Chemistry 2009 Oct; 284(50):34944.
Application：WB-Tr, Human, HEK 293T cells.
-
USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis.
Xu M, Takanashi M, Oikawa K, Tanaka M, Nishi H, Isaka K, Kudo M, Kuroda M.
Biochemical and Biophysical Research Communications 2009 Oct; 388(2):366.
Application：WB-Tr, Human, HeLa cells.
-
The Ubiquitin Specific Peptidase USP15 Regulates Human Papilloma Virus 16 E6 Protein Stability.
Vos RM, Altreuter J, White EA, Howley PM.
Journal of Virology 2009 Sep; 83(17):8885.
Application：WB-Ce, WB-Tr, Human, C33A, Caski, HeLa, SiHa, U-2 OS cells.
-
The COP9/signalosome increases the efficiency of pVHL ubiquitin ligase-mediated hypoxia inducible factor-alpha ubiquitination.
Miyauchi Y, Kato M, Tokunaga F, Iwai K.
The Journal of Biological Chemistry 2008 Apr; 283(24):16622.
Application：WB, Human, U2OS cells.
-
CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha.
Schweitzer K, Bozko PM, Dubiel W, Naumann M.
The EMBO Journal 2007 Feb; 26(6):1532.
Application：WB, Human, HeLa cells.
-
Latent CSN-CRL complexes are crucial for curcumin-induced apoptosis and recruited during adipogenesis to lipid droplets via small GTPase RAB18.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com