HS2ST1 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HS2ST1 MaxPab polyclonal antibody. Western Blot analysis of HS2ST1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of HS2ST1 expression in transfected 293T cell line (H00009653-T01) by HS2ST1 MaxPab polyclonal antibody.
Lane 1: HS2ST1 transfected lysate(25.19 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HS2ST1 protein.
Immunogen
HS2ST1 (AAH25990.1, 1 a.a. ~ 229 a.a) full-length human protein.
Sequence
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
HS2ST1 MaxPab polyclonal antibody. Western Blot analysis of HS2ST1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of HS2ST1 expression in transfected 293T cell line (H00009653-T01) by HS2ST1 MaxPab polyclonal antibody.
Lane 1: HS2ST1 transfected lysate(25.19 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HS2ST1
Entrez GeneID
9653GeneBank Accession#
BC025990.1Protein Accession#
AAH25990.1Gene Name
HS2ST1
Gene Alias
FLJ11317, KIAA0448, MGC131986, dJ604K5.2
Gene Description
heparan sulfate 2-O-sulfotransferase 1
Omim ID
604844Gene Ontology
HyperlinkGene Summary
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000011908
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com