CDC42BPB polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CDC42BPB.
Immunogen
CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag.
Sequence
SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CDC42BPB
Entrez GeneID
9578GeneBank Accession#
AF128625Protein Accession#
AAD37506Gene Name
CDC42BPB
Gene Alias
KIAA1124, MRCKB
Gene Description
CDC42 binding protein kinase beta (DMPK-like)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq
Other Designations
CDC42-binding protein kinase beta|CDC42-binding protein kinase beta (DMPK-like)|myotonic dystrophy protein kinase-like beta
-
Interactome
-
Disease
-
Publication Reference
-
A novel small-molecule MRCK inhibitor blocks cancer cell invasion.
Unbekandt M, Croft DR, Crighton D, Mezna M, McArthur D, McConnell P, Schuttelkopf AW, Belshaw S, Pannifer A, Sime M, Bower J, Drysdale M, Olson MF.
Cell Communication and Signaling 2014 Oct; 12(1):54.
Application：WB-Tr, Human, MDA-MB-231 cells.
-
Co-Crystal Structures of Inhibitors with MRCK?], a Key Regulator of Tumor Cell Invasion.
Heikkila T, Wheatley E, Crighton D, Schroder E, Boakes A, Kaye SJ, Mezna M, Pang L, Rushbrooke M, Turnbull A, Olson MF.
PLoS One 2011 Sep; 6(9):e24825.
Application：WB-Tr, Human, MDA-MB-231 cells.
-
Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive ?]-amyloid secretion.
Adachi A, Kano F, Saido TC, Murata M.
Genes to Cells 2009 Mar; 14(3):355.
Application：WB-Tr, Human, HEK-APP cells.
-
A novel small-molecule MRCK inhibitor blocks cancer cell invasion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com