- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Proteins/Peptides > Human > Partial-length > Binding > Nucleic Acid Binding > ZNF254 (Human) Recombinant Protein (Q02)
ZNF254 (Human) Recombinant Protein (Q02)
- Catalog # : H00009534-Q02
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 10 ug
- USD $ 319
- order now, ship in 5 days
-
- 25 ug
- USD $ 485
- order now, ship in 5 days
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Human ZNF254 partial ORF ( NP_004867.2, 149 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
- Sequence:
- AQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKS
- Theoretical MW (kDa):
- 32.34
- Preparation Method:
- in vitro wheat germ expression system
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Quality Control Testing:
- 12.5% SDS-PAGE Stained with Coomassie Blue.
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage Instruction:
- Store at -80°C. Aliquot to avoid repeated freezing and thawing.
- Note:
- Best use within three months from the date of receipt of this protein.
- Application Image
- Enzyme-linked Immunoabsorbent Assay
- Western Blot (Recombinant protein)
- Antibody Production
- Protein Array
- Entrez GeneID:
- 9534
- GeneBank Accession#:
- NM_004876.2
- Protein Accession#:
- NP_004867.2
- Gene Name:
- ZNF254
- Gene Alias:
- BMZF-5,FLJ58216,HD-ZNF1,ZNF539,ZNF91L
- Gene Description:
- zinc finger protein 254
- Omim ID:
- 604768
- Gene Ontology:
- Hyperlink
- Gene Summary:
- Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM
- Other Designations:
- hematopoietic-derived zinc finger protein,zinc finger protein 539
