Product Browser

Last updated: 2014/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF254 (Human) Recombinant Protein (Q02)

  • Catalog # : H00009534-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ZNF254 partial ORF ( NP_004867.2, 149 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.34
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009534-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9534
  • Gene Name:
  • ZNF254
  • Gene Alias:
  • BMZF-5,FLJ58216,HD-ZNF1,ZNF539,ZNF91L
  • Gene Description:
  • zinc finger protein 254
  • Gene Summary:
  • Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM
  • Other Designations:
  • hematopoietic-derived zinc finger protein,zinc finger protein 539
  • RSS
  • YouTube
  • Linkedin
  • Facebook