LITAF MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LITAF protein.
Immunogen
LITAF (NP_004853.2, 1 a.a. ~ 161 a.a) full-length human protein.
Sequence
MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LITAF expression in transfected 293T cell line (H00009516-T02) by LITAF MaxPab polyclonal antibody.
Lane 1: LITAF transfected lysate(17.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of LITAF transfected lysate using anti-LITAF MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LITAF purified MaxPab mouse polyclonal antibody (B01P) (H00009516-B01P). -
Gene Info — LITAF
Entrez GeneID
9516GeneBank Accession#
NM_004862.2Protein Accession#
NP_004853.2Gene Name
LITAF
Gene Alias
FLJ38636, MGC116698, MGC116700, MGC116701, MGC125274, MGC125275, MGC125276, PIG7, SIMPLE, TP53I7
Gene Description
lipopolysaccharide-induced TNF factor
Gene Ontology
HyperlinkGene Summary
Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
LPS-induced TNF-alpha factor|lipopolysaccharide-induced TNF-alpha factor|lipopolysaccharide-induced tumor necrosis factor-alpha factor|p53-induced gene 7 protein|small integral membrane protein of lysosome/late endosome|tumor protein p53 inducible protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com