Product Browser

Last updated: 2014/12/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADAMTS3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009508-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADAMTS3 partial ORF ( NP_055058.1, 1048 a.a. - 1128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.65
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009508-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9508
  • Gene Name:
  • ADAMTS3
  • Gene Alias:
  • ADAMTS-4,KIAA0366
  • Gene Description:
  • ADAM metallopeptidase with thrombospondin type 1 motif, 3
  • Gene Summary:
  • This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene is the major procollagen II N-propeptidase. A deficiency of this protein may be responsible for dermatosparaxis, a genetic defect of connective tissues. [provided by RefSeq
  • Other Designations:
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3,zinc metalloendopeptidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook