GSTO1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in human liver.
Western Blot (Tissue lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in mouse stomach.
Western Blot (Tissue lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in human placenta.
Western Blot (Cell lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of GSTO1 expression in transfected 293T cell line (H00009446-T02) by GSTO1 MaxPab polyclonal antibody.
Lane 1: GSTO1 transfected lysate(27.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTO1 protein.
Immunogen
GSTO1 (NP_004823.1, 1 a.a. ~ 241 a.a) full-length human protein.
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (72); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in human liver.Western Blot (Tissue lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in mouse stomach.Western Blot (Tissue lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in human placenta.Western Blot (Cell lysate)
GSTO1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of GSTO1 expression in transfected 293T cell line (H00009446-T02) by GSTO1 MaxPab polyclonal antibody.
Lane 1: GSTO1 transfected lysate(27.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GSTO1
Entrez GeneID
9446GeneBank Accession#
NM_004832.1Protein Accession#
NP_004823.1Gene Name
GSTO1
Gene Alias
DKFZp686H13163, GSTTLp28, P28
Gene Description
glutathione S-transferase omega 1
Omim ID
605482Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq
Other Designations
OTTHUMP00000020429|glutathione S-transferase omega 1-1|glutathione transferase omega 1|glutathione-S-transferase like|glutathione-S-transferase omega 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com