ABCG2 (Human) Recombinant Protein (Q02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ABCG2 partial ORF ( NP_004818.2, 156 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGRLM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ABCG2
Entrez GeneID
9429GeneBank Accession#
NM_004827Protein Accession#
NP_004818.2Gene Name
ABCG2
Gene Alias
ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, EST157481, MGC102821, MRX, MXR, MXR1
Gene Description
ATP-binding cassette, sub-family G (WHITE), member 2
Omim ID
603756Gene Ontology
HyperlinkGene Summary
The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. [provided by RefSeq
Other Designations
ABC transporter|ATP-binding cassette transporter G2|ATP-binding cassette, sub-family G, member 2|breast cancer resistance protein|mitoxantrone resistance protein|placenta specific MDR protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com