CDY2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDY2 partial ORF ( NP_004816, 123 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.86
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDY2A
Entrez GeneID
9426GeneBank Accession#
NM_004825Protein Accession#
NP_004816Gene Name
CDY2A
Gene Alias
CDY, CDY2
Gene Description
chromodomain protein, Y-linked, 2A
Omim ID
400018Gene Ontology
HyperlinkGene Summary
This intronless gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. [provided by RefSeq
Other Designations
Y chromosome chromodomain protein 2A|chromodomain protein, Y chromosome, 2|testis-specific chromodomain protein Y protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com