Product Browser

Last updated: 2014/9/1

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIPG (Human) Recombinant Protein (Q01)

  • Catalog # : H00009388-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LIPG partial ORF ( NP_006024, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009388-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9388
  • Gene Name:
  • LIPG
  • Gene Alias:
  • EDL,EL,PRO719
  • Gene Description:
  • lipase, endothelial
  • Gene Summary:
  • The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. [provided by RefSeq
  • Other Designations:
  • endothelial cell-derived lipase,endothelial lipase,lipoprotein lipase H
  • RSS
  • YouTube
  • Linkedin
  • Facebook