SNAP29 monoclonal antibody (M01), clone 3E4-E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SNAP29 expression in transfected 293T cell line by SNAP29 monoclonal antibody (M01), clone 3E4-E6.
Lane 1: SNAP29 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNAP29 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAP29 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (54.12 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SNAP29.
Immunogen
SNAP29 (AAH09715, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (83)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.12 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SNAP29 expression in transfected 293T cell line by SNAP29 monoclonal antibody (M01), clone 3E4-E6.
Lane 1: SNAP29 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNAP29 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAP29 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SNAP29
Entrez GeneID
9342GeneBank Accession#
BC009715Protein Accession#
AAH09715Gene Name
SNAP29
Gene Alias
CEDNIK, FLJ21051, SNAP-29
Gene Description
synaptosomal-associated protein, 29kDa
Gene Ontology
HyperlinkGene Summary
This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq
Other Designations
soluble 29 kDa NSF attachment protein|synaptosomal-associated protein 29|vesicle-membrane fusion protein SNAP-29
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
SNARE protein expression and localization in human cytotoxic T lymphocytes.
Pattu V, Qu B, Schwarz EC, Straubeta B, Weins L, Bhat SS, Halimani M, Marshall M, Rettig J, Hoth M.
European Journal of Immunology 2012 Feb; 42(2):470.
Application：IF, Human, Raji cells, CTLs.
-
SNARE protein expression and localization in human cytotoxic T lymphocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com