UBE2L6 monoclonal antibody (M01), clone 2F12-1F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant UBE2L6.
Immunogen
UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (73)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.57 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody (M01), clone 2F12-1F4.
Lane 1: UBE2L6 transfected lysate(17.595 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2L6 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — UBE2L6
Entrez GeneID
9246GeneBank Accession#
BC032491Protein Accession#
AAH32491Gene Name
UBE2L6
Gene Alias
MGC40331, RIG-B, UBCH8
Gene Description
ubiquitin-conjugating enzyme E2L 6
Omim ID
603890Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
retinoic acid induced gene B protein|ubiquitin carrier protein|ubiquitin-protein ligase
-
Interactome
-
Pathway
-
Publication Reference
-
Interactions between PBEF and oxidative stress proteins - A potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ.
FEBS Letters 2008 May; 582(13):1802.
Application:WB, Human, Human primary pulmonary artery endothelial cells, Human primary lung microvascular endothelial cells.
-
Interactions between PBEF and oxidative stress proteins - A potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com