UBE2L6 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UBE2L6 protein.
Immunogen
UBE2L6 (NP_004214.1, 1 a.a. ~ 153 a.a) full-length human protein.
Sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Cell lysate)
UBE2L6 MaxPab polyclonal antibody. Western Blot analysis of UBE2L6 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of UBE2L6 expression in transfected 293T cell line (H00009246-T01) by UBE2L6 MaxPab polyclonal antibody.
Lane 1: UBE2L6 transfected lysate(16.83 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UBE2L6
Entrez GeneID
9246GeneBank Accession#
NM_004223.3Protein Accession#
NP_004214.1Gene Name
UBE2L6
Gene Alias
MGC40331, RIG-B, UBCH8
Gene Description
ubiquitin-conjugating enzyme E2L 6
Omim ID
603890Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
retinoic acid induced gene B protein|ubiquitin carrier protein|ubiquitin-protein ligase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com