IL32 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IL32 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL32 expression in human spleen.
Western Blot (Tissue lysate)
IL32 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL32 expression in mouse lung.
Western Blot (Transfected lysate)
Western Blot analysis of IL32 expression in transfected 293T cell line (H00009235-T02) by IL32 MaxPab polyclonal antibody.
Lane 1: IL32 transfected lysate(21.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL32 protein.
Immunogen
IL32 (NP_001012649.1, 1 a.a. ~ 188 a.a) full-length human protein.
Sequence
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IL32 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL32 expression in human spleen.Western Blot (Tissue lysate)
IL32 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL32 expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of IL32 expression in transfected 293T cell line (H00009235-T02) by IL32 MaxPab polyclonal antibody.
Lane 1: IL32 transfected lysate(21.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IL32
Entrez GeneID
9235GeneBank Accession#
NM_001012631Protein Accession#
NP_001012649.1Gene Name
IL32
Gene Alias
IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
Gene Description
interleukin 32
Omim ID
606001Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
natural killer cell transcript 4|natural killer cells protein 4|tumor necrosis factor alpha-inducing factor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com