AURKB monoclonal antibody (M04), clone 6G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AURKB.
Immunogen
AURKB (AAH09751, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody (M04), clone 6G8.
Lane 1: AURKB transfected lysate(39.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AURKB is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AURKB over-expressed 293 cell line, cotransfected with AURKB Validated Chimera RNAi ( Cat # H00009212-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AURKB monoclonal antibody (M04) clone 6G8 (Cat # H00009212-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — AURKB
Entrez GeneID
9212GeneBank Accession#
BC009751Protein Accession#
AAH09751Gene Name
AURKB
Gene Alias
AIK2, AIM-1, AIM1, ARK2, AurB, IPL1, STK12, STK5
Gene Description
aurora kinase B
Omim ID
604970Gene Ontology
HyperlinkGene Summary
Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases associate with microtubules during chromosome movement and segregation. Aurora kinase B localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers, and Aurora kinase A (MIM 603072) localizes to centrosomes (Lampson et al., 2004 [PubMed 14767480]).[supplied by OMIM
Other Designations
aurora-1|aurora-B|serine/threonine kinase 12
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com