Product Browser

Last updated: 2014/7/7
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP4M1 polyclonal antibody (A01)

  • Catalog # : H00009179-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AP4M1.
  • Immunogen:
  • AP4M1 (NP_004713, 354 a.a. ~ 453 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009179-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9179
  • Gene Name:
  • AP4M1
  • Gene Alias:
  • MU-4,MU-ARP2
  • Gene Description:
  • adaptor-related protein complex 4, mu 1 subunit
  • Gene Summary:
  • This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. [provided by RefSeq
  • Other Designations:
  • AP-4 adapter complex mu subunit,adaptor-related protein complex AP-4 mu4 subunit,mu subunit of AP-4,mu-adaptin-related protein-2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook