CCNE2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCNE2 protein.
Immunogen
CCNE2 (NP_477097.1, 1 a.a. ~ 404 a.a) full-length human protein.
Sequence
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CCNE2 MaxPab rabbit polyclonal antibody. Western Blot analysis of CCNE2 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of CCNE2 expression in transfected 293T cell line (H00009134-T03) by CCNE2 MaxPab polyclonal antibody.
Lane 1: CCNE2 transfected lysate(46.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCNE2
Entrez GeneID
9134GeneBank Accession#
NM_057749Protein Accession#
NP_477097.1Gene Name
CCNE2
Gene Alias
CYCE2
Gene Description
cyclin E2
Omim ID
603775Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq
Other Designations
G1/S-specific cyclin E2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com