UBE2M monoclonal antibody (M01), clone 3C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UBE2M monoclonal antibody (M01), clone 3C4 Western Blot analysis of UBE2M expression in Jurkat ( Cat # L017V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2M is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBE2M on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (45.87 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant UBE2M.
Immunogen
UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE2M monoclonal antibody (M01), clone 3C4 Western Blot analysis of UBE2M expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2M is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBE2M on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UBE2M
Entrez GeneID
9040GeneBank Accession#
BC058924Protein Accession#
AAH58924Gene Name
UBE2M
Gene Alias
UBC-RS2, UBC12, hUbc12
Gene Description
ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Omim ID
603173Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. [provided by RefSeq
Other Designations
nedd8-conjugating enzyme Ubc12|ubiquitin carrier protein M|ubiquitin-conjugating enzyme E2M|ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12)|ubiquitin-protein ligase M|yeast UBC12 homolog
-
Interactome
-
Pathway
-
Publication Reference
-
Application of an integrated physical and functional screening approach to identify inhibitors of the Wnt pathway.
Miller BW, Lau G, Grouios C, Mollica E, Barrios-Rodiles M, Liu Y, Datti A, Morris Q, Wrana JL, Attisano L.
Molecular Systems Biology 2009 Oct; 5:315.
Application：WB, Human, HEK 293T cells.
-
Application of an integrated physical and functional screening approach to identify inhibitors of the Wnt pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com