H1FX purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
H1FX MaxPab polyclonal antibody. Western Blot analysis of H1FX expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of H1FX expression in transfected 293T cell line (H00008971-T02) by H1FX MaxPab polyclonal antibody.
Lane 1: H1FX transfected lysate(23.43 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to H1FX on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human H1FX protein.
Immunogen
H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length human protein.
Sequence
MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (69)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
H1FX MaxPab polyclonal antibody. Western Blot analysis of H1FX expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of H1FX expression in transfected 293T cell line (H00008971-T02) by H1FX MaxPab polyclonal antibody.
Lane 1: H1FX transfected lysate(23.43 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to H1FX on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — H1FX
Entrez GeneID
8971GeneBank Accession#
NM_006026Protein Accession#
NP_006017.1Gene Name
H1FX
Gene Alias
H1X, MGC15959, MGC8350
Gene Description
H1 histone family, member X
Omim ID
602785Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H1 family. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com