EIF2S2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EIF2S2 partial ORF ( NP_003899.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EIF2S2
Entrez GeneID
8894GeneBank Accession#
NM_003908Protein Accession#
NP_003899.2Gene Name
EIF2S2
Gene Alias
DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC8508
Gene Description
eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Omim ID
603908Gene Ontology
HyperlinkGene Summary
Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq
Other Designations
OTTHUMP00000030680|eukaryotic initiation factor 2-beta|eukaryotic translation initiation factor 2 beta|eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com