DDEF2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DDEF2.
Immunogen
DDEF2 (NP_003878, 909 a.a. ~ 1006 a.a) partial recombinant protein with GST tag.
Sequence
RGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DDEF2 polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of DDEF2 expression in SJCRH30 ( Cat # L027V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ASAP2
Entrez GeneID
8853GeneBank Accession#
NM_003887Protein Accession#
NP_003878Gene Name
ASAP2
Gene Alias
AMAP2, CENTB3, DDEF2, FLJ42910, KIAA0400, PAG3, PAP, Pap-alpha, SHAG1
Gene Description
ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
Omim ID
603817Gene Ontology
HyperlinkGene Summary
This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The protein localizes in the Golgi apparatus and at the plasma membrane, where it colocalizes with protein tyrosine kinase 2-beta (PYK2). The encoded protein forms a stable complex with PYK2 in vivo. This interaction appears to be mediated by binding of its SH3 domain to the C-terminal proline-rich domain of PYK2. The encoded protein is tyrosine phosphorylated by activated PYK2. It has catalytic activity for class I and II ArfGAPs in vitro, and can bind the class III Arf ARF6 without immediate GAP activity. The encoded protein is believed to function as an ARF GAP that controls ARF-mediated vesicle budding when recruited to Golgi membranes. In addition, it functions as a substrate and downstream target for PYK2 and SRC, a pathway that may be involved in the regulation of vesicular transport. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
PYK2 C terminus-associated protein|centaurin, beta 3|development and differentiation enhancing factor 2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com