TRIM24 monoclonal antibody (M01), clone 2F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM24.
Immunogen
TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.81 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIM24 monoclonal antibody (M01), clone 2F2. Western Blot analysis of TRIM24 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
TRIM24 monoclonal antibody (M01), clone 2F2 Western Blot analysis of TRIM24 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody (M01), clone 2F2.
Lane 1: TRIM24 transfected lysate(116.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml]Immunoprecipitation
Immunoprecipitation of TRIM24 transfected lysate using anti-TRIM24 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM24 MaxPab rabbit polyclonal antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIM24 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TRIM24
Entrez GeneID
8805GeneBank Accession#
BC028689Protein Accession#
AAH28689Gene Name
TRIM24
Gene Alias
PTC6, RNF82, TF1A, TIF1, TIF1A, TIF1ALPHA, hTIF1
Gene Description
tripartite motif-containing 24
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
transcriptional intermediary factor 1|transcriptional intermediary factor 1 alpha|tripartite motif protein 24
-
Interactome
-
Publication Reference
-
BioID identifies novel c-MYC interacting partners in cultured cells and xenograft tumors.
Dingar D, Kalkat M, Chan PK, Srikumar T, Bailey SD, Tu WB, Coyaud E, Ponzielli R, Kolyar M, Jurisica I, Huang A, Lupien M, Penn LZ, Raught B.
Journal of Proteomics 2015 Apr; 118:95.
Application:PLA, Human, MCF10A cells.
-
Overexpression of TRIM24 Is Associated with the Onset and Progress of Human Hepatocellular Carcinoma.
Liu X, Huang Y, Yang D, Li X, Liang J, Lin L, Zhang M, Zhong K, Liang B, Li J.
PLoS One 2014 Jan; 9(1):e85462.
Application:IHC-P, WB-Tr, Human, Hepatocellular carcinoma, HepG2 cells.
-
TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells.
Misato Kikuchi, Fumihiko Okumura, Tadasuke Tsukiyama, Masashi Watanabe, Naoto Miyajima, Junji Tanaka, Masahiro Imamura, Shigetsugu Hatakeyama.
Biochimica et Biophysica Acta 2009 Dec; 1793(12):1828.
Application:WB-Ce, WB-Tr, Human, CWR22Rv1, LNCaP, PC-3 cells.
-
BioID identifies novel c-MYC interacting partners in cultured cells and xenograft tumors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com