EDF1 MaxPab mouse polyclonal antibody (B02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EDF1 protein.
Immunogen
EDF1 (NP_003783.1, 1 a.a. ~ 148 a.a) full-length human protein.
Sequence
MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EDF1 expression in transfected 293T cell line (H00008721-T02) by EDF1 MaxPab polyclonal antibody.
Lane 1: EDF1 transfected lysate(16.28 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to EDF1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EDF1
Entrez GeneID
8721GeneBank Accession#
NM_003792.2Protein Accession#
NP_003783.1Gene Name
EDF1
Gene Alias
EDF-1, MBF1, MGC9058
Gene Description
endothelial differentiation-related factor 1
Omim ID
605107Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022616|OTTHUMP00000022617|multiprotein bridging factor 1|multiprotein bridging factor-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com