MAPKAPK5 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line (H00008550-T02) by MAPKAPK5 MaxPab polyclonal antibody.
Lane 1: MAPKAPK5 transfected lysate(54.00 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPKAPK5 and EIF4EBP1. HeLa cells were stained with anti-MAPKAPK5 rabbit purified polyclonal 1:1200 and anti-EIF4EBP1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MAPKAPK5 protein.
Immunogen
MAPKAPK5 (NP_003659.2, 1 a.a. ~ 471 a.a) full-length human protein.
Sequence
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line (H00008550-T02) by MAPKAPK5 MaxPab polyclonal antibody.
Lane 1: MAPKAPK5 transfected lysate(54.00 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPKAPK5 and EIF4EBP1. HeLa cells were stained with anti-MAPKAPK5 rabbit purified polyclonal 1:1200 and anti-EIF4EBP1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — MAPKAPK5
Entrez GeneID
8550GeneBank Accession#
NM_003668.2Protein Accession#
NP_003659.2Gene Name
MAPKAPK5
Gene Alias
PRAK
Gene Description
mitogen-activated protein kinase-activated protein kinase 5
Omim ID
606723Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
p38-regulated/activated protein kinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com